BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHsf1 protein
LigandBDBM13076
Substrate/Competitorn/a
Meas. Tech.Luminescence Cell-Based Dose Confimation HTS to Identify Inhibitors of Heat Shock Factor 1 (HSF1)
EC50>195000±0 nM
Citation PubChem, PC Luminescence Cell-Based Dose Confimation HTS to Identify Inhibitors of Heat Shock Factor 1 (HSF1) PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hsf1 protein
Name:Hsf1 protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57208.68
Organism:Mus musculus
Description:P38532
Residue:525
Sequence:
MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLSDSNSAHSVPKYGRQYSLEHVHGPGPY
SAPSPAYSSSSLYSSDAVTSSGPIISDITELAPTSPLASPGRSIDERPLSSSTLVRVKQE
PPSPPHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPAL
PTPSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDLFSPSVTM
PDMSLPDLDSSLASIQELLSPQEPPRPIEAENSNPDSGKQLVHYTAQPLFLLDPDAVDTG
SSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13076
NameBDBM13076
Synonyms:6-chloro-1,1-dioxo-3,4-dihydro-2H-1,2,4-benzothiadiazine-7-sulfonamide | BMCL182567 Compound 6a | Dichlothiazide | Hydro-D | Hydrochlorothiazide | Hypothiazide | JFD00715 | Oretic | cid_3639
TypeSmall organic molecule
Emp. Form.C7H8ClN3O4S2
Mol. Mass.297.739
SMILESNS(=O)(=O)c1cc2c(NCNS2(=O)=O)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a