BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPPP5C protein
LigandBDBM32033
Substrate/Competitorn/a
Meas. Tech.Fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 5 (PP5)
IC50 10299±n/a nM
Citation PubChem, PC Fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 5 (PP5) PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
PPP5C protein
Name:PPP5C protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:55092.68
Organism:Homo sapiens
Description:gi_37589898
Residue:484
Sequence:
MAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNA
IYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETV
VKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLE
DGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGD
THGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRG
NHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVT
LDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDY
IIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVGRP
SSGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32033
NameBDBM32033
Synonyms:1-butyl-2-(2-furoylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylic acid ethyl ester | 1-butyl-2-[[2-furanyl(oxo)methyl]amino]-3-pyrrolo[3,2-b]quinoxalinecarboxylic acid ethyl ester | MLS000079916 | SMR000040037 | cid_659124 | ethyl 1-butyl-2-(furan-2-carbonylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylate | ethyl 1-butyl-2-(furan-2-ylcarbonylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylate
TypeSmall organic molecule
Emp. Form.C22H22N4O4
Mol. Mass.406.4345
SMILESCCCCn1c(NC(=O)c2ccco2)c(C(=O)OCC)c2nc3ccccc3nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a