BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetheat shock protein 90
LigandBDBM64911
Substrate/Competitorn/a
Meas. Tech.Fluorescence Cell-Based Secondary Assay to Identify Inhibitors of Resistant C. albicans Growth in the Presence of Fluconazole
EC50>150000±0 nM
Citation PubChem, PC Fluorescence Cell-Based Secondary Assay to Identify Inhibitors of Resistant C. albicans Growth in the Presence of Fluconazole PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
heat shock protein 90
Name:heat shock protein 90
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:80784.12
Organism:Candida albicans
Description:gi_994798
Residue:707
Sequence:
MADAKVETHEFTAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPSQLE
SEPELFIRIIPQKDQKVLEIRDSGIGMTKADLVNNLGTIAKSGTKSFMEALSAGADVSMI
GQFGVGFYSLFLVADHVQVISKHNDDEQYVWESNAGGKFTVTLDETNERLGRGTMLRLFL
KEDQLEYLEEKRIKEVVKKHSEFVAYPIQLVVTKEVEKEVPETEEEDKAAEEDDKKPKLE
EVKDEEDEKKEKKTKTVKEEVTETEELNKTKPLWTRNPSDITQDEYNAFYKSISNDWEDP
LAVKHFSVEGQLEFRAILFVPKRAPFDAFESKKKKNNIKLYVRRVFITDDAEELIPEWLS
FIKGVVDSEDLPLNLSREMLQQNKILKVIRKNIVKKMIETFNEISEDQEQFNQFYTAFSK
NIKLGIHEDAQNRQSLAKLLRFYSTKSSEEMTSLSDYVTRMPEHQKNIYYITGESIKAVE
KSPFLDALKAKNFEVLFMVDPIDEYAMTQLKEFEDKKLVDITKDFELEESDEEKAAREKE
IKEYEPLTKALKDILGDQVEKVVVSYKLVDAPAAIRTGQFGWSANMERIMKAQALRDTTM
SSYMSSKKTFEISPSSPIIKELKKKVETDGAEDKTVKDLTTLLFDTALLTSGFTLDEPSN
FAHRINRLIALGLNIDDDSEETAVEPEATTTASTDEPAGESAMEEVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM64911
NameBDBM64911
Synonyms:4-[(7-butyl-1,3-dimethyl-2,6-dioxo-8-purinyl)methyl]-1-piperazinecarboxylic acid ethyl ester | 4-[(7-butyl-2,6-diketo-1,3-dimethyl-purin-8-yl)methyl]piperazine-1-carboxylic acid ethyl ester | MLS000039617 | SMR000035251 | cid_666088 | ethyl 4-[(7-butyl-1,3-dimethyl-2,6-dioxopurin-8-yl)methyl]piperazine-1-carboxylate | ethyl 4-[[7-butyl-1,3-dimethyl-2,6-bis(oxidanylidene)purin-8-yl]methyl]piperazine-1-carboxylate
TypeSmall organic molecule
Emp. Form.C19H30N6O4
Mol. Mass.406.4793
SMILESCCCCn1c(CN2CCN(CC2)C(=O)OCC)nc2n(C)c(=O)n(C)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a