BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targettransient receptor potential cation channel, subfamily N, member 1
LigandBDBM46955
Substrate/Competitorn/a
Meas. Tech.Late stage counterscreen for the probe development effort to identify selective agonists of the Transient Receptor Potential Channels 3 (TRPML3)
EC50>29900±n/a nM
Citation PubChem, PC Late stage counterscreen for the probe development effort to identify selective agonists of the Transient Receptor Potential Channels 3 (TRPML3): fluorescence-based cell-based dose response assay for TRPN1 agonists. PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
transient receptor potential cation channel, subfamily N, member 1
Name:transient receptor potential cation channel, subfamily N, member 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:175824.78
Organism:Danio rerio
Description:Q7T1G6
Residue:1614
Sequence:
MSESSCVSGAPQRLVPLALRGEWMALEQKIKTLERGDPDILQCDEESGMSLLMLAVRESR
LSVLDRLLELGANPSDKTKDGRSALHIAAAHSKDEIVKLLVRKTDPNSPAGPNDQLPLHY
AASRSTGGLAVVQTLLKFSSKDARLTPDKNGCLPLLLAAEAGNVGIVRELLSSQSEPQIR
AAKTANGDTALHICCRRRDVEMAKILVEFGANPDSQNDEGQTPLHIAAHEGDENMLKFLY
LCKANANISDKMDRSPLHIAAERGHTNVVEILTEKFRSCVLARTKDGNTLLHIASQCGHP
TTALSFLRKGVPLHMPNKSGAVCLHAAAKRGHTAVVKALLQKGAHVDAAARDGQTALHIA
VENCRPQVVQMLLGFGAHVQLRGGKAQETPLHISARVKEGERAAEMLLKSGAEVNAEQEN
GETALHVAARHGSLQMIRALIQEGGDPRWRSRVGESPLHVAVRHCHAHVVQEILTFLTNE
KSRRDAELCVCEGNQDGETALHLAAELRTDALHQPEEDITIIQILMEHQADITAVTRQTG
ETPLHYSARVGNTAVLQEMLRNVPTNQIQTAINKHSKNGWSPLLLAADQGHTEVVKILLQ
NNARVDVFDEEGKAAIHLAAQRGHQDIVDVLLSQKAFVNAKTKQGLTPLHLSAQNGSARL
VRLLVENHQASVDALSLRKQTPLHLAAMSGQLDVCSSLLNLRADITATDSRGQTPLHLAA
ESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHKA
HGLCPLHLAAAGGHAEVVKVLLEAGASVTEEDAEGMTAVHLAAKHGHTHILEVLRGSVPL
KIQSSKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTISGKDDIKRQQPLAESGFT
PLHLASQSGHESVVRLLLNCPGVQADAETNIQGSSPLHLAAQSGHTAVVGLLLSRSSSLL
HQADRRGRSALHLAAAHGHVDMVRVLLGQGAEINHTDMSGWTALHYAAEAGCLEVLLFLV
ESGASACAECHGGRTPLQYAAQQNHESAVIFLLRREKNTLRLLDDKKFIFNLMVCGRMND
NLSLEELVLHTSAPLDTAVRLSRALTLCALREKERSVDLQAAAHHCELMASDLLSLSASA
GGQGAGAGPILRALDHRGLSVLDCLIEGRQKGVVSQPAVQTYLTEVWCGGLQWDSWKILL
LFCCLLLCPPLWLLLALPLTHSFNTIPIVKFMSHLVSHIFLLTLFILTIVYPPVSPLSQA
RLMPSWSECLLLIWLCGMLVSELTFPGERTGLAWIRLLLLGFSAAALLCHLLAVFTQWWP
PTHLHCLFARNVLLAVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILMLFH
TAFTLSLTALCQPLYPQEQHNTTTEVTVPGPLNMSVLLFFALFGLTEPDKIPDVDRSPPA
TAVLAKMVFGVYLVVTFIVLINLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGI
PSPFNLFTNLFYSVKVVCKRAGKMCSSESRDVMNEDEDAEGLSESRSLDLLSQASVSGIR
GNKRTQILPEGGQISLAHSGGHVRVENVADWPSVVQQFLSQRRQRDRSTAERDE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM46955
NameBDBM46955
Synonyms:4-methyl-1-(4-propan-2-ylphenyl)sulfonyl-piperidine | 4-methyl-1-(4-propan-2-ylphenyl)sulfonylpiperidine | 4-methyl-1-p-cumenylsulfonyl-piperidine | MLS000706525 | SMR000272691 | cid_801435
TypeSmall organic molecule
Emp. Form.C15H23NO2S
Mol. Mass.281.414
SMILESCC(C)c1ccc(cc1)S(=O)(=O)N1CCC(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a