Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1,5-anhydro-D-fructose reductase
LigandBDBM269076
Substrate/Competitorn/a
Meas. Tech.Fatty Acid Synthase Keto-reductase Domain (FASN KR) Inhibition
pH7.5±n/a
Temperature298.15±n/a K
IC50 389±n/a nM
Commentsextracted
Citation Connolly, PJLu, T Imidazolin-5-one derivative useful as FASN inhibitors for the treatment of cancer US Patent US9718813 Publication Date 8/1/2017
More Info.:Get all data from this article,  Assay Method
 
1,5-anhydro-D-fructose reductase
Name:1,5-anhydro-D-fructose reductase
Synonyms:AF reductase | Aldo-keto reductase family 1 member C-like protein 2 | Aldo-keto reductase family 1 member E2 | LoopADR
Type:Enzyme Catalytic Domain
Mol. Mass.:36595.42
Organism:Homo sapiens (Human)
Description:Q96JD6
Residue:320
Sequence:
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVR
REDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSE
LSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERL
LNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKR
IAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNL
RLAMFPITKNHKDYPFHIEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM269076
NameBDBM269076
Synonyms:(4RS)-2-(4-(Benzofuran-5-yl)phenyl)-1-(((R)-1-(cyclopropanecarbonyl)pyrrolidin-3-yl)methyl)-4-(methoxymethyl)-4-methyl-1H-imidazol-5(4H)-one | US9718813, Compound 8
TypeSmall organic molecule
Emp. Form.C29H31N3O4
Mol. Mass.485.5741
SMILESCOCC1(C)N=C(N(C[C@@H]2CCN(C2)C(=O)C2CC2)C1=O)c1ccc(cc1)-c1ccc2occc2c1 |r,c:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a