BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkanal monooxygenase alpha chain
LigandBDBM65979
Substrate/Competitorn/a
Meas. Tech.Absorbance Microorganism Dose Retest to Identify Inhibitors of Vibrio harveyi
EC50>160000±n/a nM
Citation PubChem, PC Absorbance Microorganism Dose Retest to Identify Inhibitors of Vibrio harveyi PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkanal monooxygenase alpha chain
Name:Alkanal monooxygenase alpha chain
Synonyms:Bacterial luciferase alpha chain
Type:Enzyme Catalytic Domain
Mol. Mass.:40139.12
Organism:Vibrio harveyi
Description:gi_126509
Residue:355
Sequence:
MKFGNFLLTYQPPELSQTEVMKRLVNLGKASEGCGFDTVWLLEHHFTEFGLLGNPYVAAA
HLLGATETLNVGTAAIVLPTAHPVRQAEDVNLLDQMSKGRFRFGICRGLYDKDFRVFGTD
MDNSRALMDCWYDLMKEGFNEGYIAADNEHIKFPKIQLNPSAYTQGGAPVYVVAESASTT
EWAAERGLPMILSWIINTHEKKAQLDLYNEVATEHGYDVTKIDHCLSYITSVDHDSNRAK
DICRNFLGHWYDSYVNATKIFDDSDQTKGYDFNKGQWRDFVLKGHKDTNRRIDYSYEINP
VGTPEECIAIIQQDIDATGIDNICCGFEANGSEEEIIASMKLFQSDVMPYLKEKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65979
NameBDBM65979
Synonyms:1-methyl-N-[4-(trifluoromethoxy)phenyl]-1H-imidazole-4-sulfonamide | 1-methyl-N-[4-(trifluoromethoxy)phenyl]-4-imidazolesulfonamide | 1-methyl-N-[4-(trifluoromethoxy)phenyl]imidazole-4-sulfonamide | 1-methyl-N-[4-(trifluoromethyloxy)phenyl]imidazole-4-sulfonamide | MLS000673272 | SMR000314513 | cid_2821584
TypeSmall organic molecule
Emp. Form.C11H10F3N3O3S
Mol. Mass.321.276
SMILESCn1cnc(c1)S(=O)(=O)Nc1ccc(OC(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a