BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkanal monooxygenase alpha chain
LigandBDBM65978
Substrate/Competitorn/a
Meas. Tech.Luminescence Microorganism Dose Retest to Identify Inhibitors of the AI-2 Quorum Sensing System
EC50>160000±n/a nM
Citation PubChem, PC Luminescence Microorganism Dose Retest to Identify Inhibitors of the AI-2 Quorum Sensing System PubChem Bioassay(2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkanal monooxygenase alpha chain
Name:Alkanal monooxygenase alpha chain
Synonyms:Bacterial luciferase alpha chain
Type:Enzyme Catalytic Domain
Mol. Mass.:40139.12
Organism:Vibrio harveyi
Description:gi_126509
Residue:355
Sequence:
MKFGNFLLTYQPPELSQTEVMKRLVNLGKASEGCGFDTVWLLEHHFTEFGLLGNPYVAAA
HLLGATETLNVGTAAIVLPTAHPVRQAEDVNLLDQMSKGRFRFGICRGLYDKDFRVFGTD
MDNSRALMDCWYDLMKEGFNEGYIAADNEHIKFPKIQLNPSAYTQGGAPVYVVAESASTT
EWAAERGLPMILSWIINTHEKKAQLDLYNEVATEHGYDVTKIDHCLSYITSVDHDSNRAK
DICRNFLGHWYDSYVNATKIFDDSDQTKGYDFNKGQWRDFVLKGHKDTNRRIDYSYEINP
VGTPEECIAIIQQDIDATGIDNICCGFEANGSEEEIIASMKLFQSDVMPYLKEKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65978
NameBDBM65978
Synonyms:MLS000690454 | N-[({4-[(dimethylamino)sulfonyl]phenyl}amino)carbonothioyl]-2-phenylacetamide | N-[[4-(dimethylsulfamoyl)anilino]-sulfanylidenemethyl]-2-phenylacetamide | N-[[4-(dimethylsulfamoyl)phenyl]carbamothioyl]-2-phenyl-ethanamide | N-[[4-(dimethylsulfamoyl)phenyl]carbamothioyl]-2-phenylacetamide | N-[[4-(dimethylsulfamoyl)phenyl]thiocarbamoyl]-2-phenyl-acetamide | SMR000300303 | cid_2214684
TypeSmall organic molecule
Emp. Form.C17H19N3O3S2
Mol. Mass.377.481
SMILESCN(C)S(=O)(=O)c1ccc(NC(=S)NC(=O)Cc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a