BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAgp1p
LigandBDBM41480
Substrate/Competitorn/a
Meas. Tech.Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically AGP1 based on MLPCN hits
EC50 6921±n/a nM
Citation PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically AGP1 based on MLPCN hits PubChem Bioassay(2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Agp1p
Name:Agp1p
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:69674.09
Organism:Saccharomyces cerevisiae S288c
Description:gi_85666113
Residue:633
Sequence:
MSSSKSLYELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFF
DSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTI
QPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYS
NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVII
FYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDP
GAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFL
FLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMA
NSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFT
WLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILIL
IAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHR
QIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM41480
NameBDBM41480
Synonyms:1-[4-[4-(4-bromobenzoyl)piperazin-1-yl]-3-fluorophenyl]ethanone | 1-[4-[4-(4-bromobenzoyl)piperazino]-3-fluoro-phenyl]ethanone | 1-[4-[4-(4-bromophenyl)carbonylpiperazin-1-yl]-3-fluoranyl-phenyl]ethanone | 1-[4-[4-[(4-bromophenyl)-oxomethyl]-1-piperazinyl]-3-fluorophenyl]ethanone | MLS000109371 | SMR000105314 | cid_1239154
TypeSmall organic molecule
Emp. Form.C19H18BrFN2O2
Mol. Mass.405.261
SMILESCC(=O)c1ccc(N2CCN(CC2)C(=O)c2ccc(Br)cc2)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a