BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAgp1p
LigandBDBM61536
Substrate/Competitorn/a
Meas. Tech.Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically AGP1 based on MLPCN hits
EC50 570±n/a nM
Citation PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically AGP1 based on MLPCN hits PubChem Bioassay(2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Agp1p
Name:Agp1p
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:69674.09
Organism:Saccharomyces cerevisiae S288c
Description:gi_85666113
Residue:633
Sequence:
MSSSKSLYELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFF
DSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTI
QPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYS
NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVII
FYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDP
GAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFL
FLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMA
NSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFT
WLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILIL
IAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHR
QIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM61536
NameBDBM61536
Synonyms:2-chloranyl-4,4-dimethyl-3-oxidanylidene-N-phenyl-pentanamide | 2-chloro-3-keto-4,4-dimethyl-N-phenyl-valeramide | 2-chloro-4,4-dimethyl-3-oxo-N-phenylpentanamide | MLS000710931 | SMR000280697 | cid_3091421
TypeSmall organic molecule
Emp. Form.C13H16ClNO2
Mol. Mass.253.725
SMILESCC(C)(C)C(=O)C(Cl)C(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a