BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLAP4
LigandBDBM64987
Substrate/Competitorn/a
Meas. Tech.Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically LAP4 based on MLPCN hits
EC50 607±n/a nM
Citation PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically LAP4 based on MLPCN hits PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
LAP4
Name:LAP4
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57084.90
Organism:Saccharomyces cerevisiae
Description:gi_486173
Residue:514
Sequence:
MEEQREILEQLKKTLQMLTVEPSKNNQIANEEKEKKENENSWCILEHNYEDIAQEFIDFI
YKNPTTYHVVSFFAELLDKHNFKYLSEKSNWQDSIGEDGGKFYTIRNGTNLSAFILGKNW
RAEKGVGVIGSHVDALTVKLKPVSFKDTAEGYGRIAVAPYGGTLNELWLDRDLGIGGRLL
YKKKGTNEIKSALVDSTPLPVCRIPSLAPHFGKPAEGPFDKEDQTIPVIGFPTPDEEGNE
PPTDDEKKSPLFGKHCIHLLRYVAKLAGVEVSELIQMDLDLFDVQKGTIGGIGKHFLFAP
RLDDRLCSFAAMIALICYAKDVNTEESDLFSTVTLYDNEEIGSLTRQGAKGGLLESVVER
SSSAFTKKPVDLHTVWANSIILSADVNHLYNPNFPEVYLKNHFPVPNVGITLSLDPNGHM
ATDVVGTALVEELARRNGDKVQYFQIKNNSRSGGTIGPSLASQTGARTIDLGIAQLSMHS
IRAATGSKDVGLGVKFFNGFFKHWRSVYDEFGEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM64987
NameBDBM64987
Synonyms:5-nitro-8-quinolinol | 5-nitroquinolin-8-ol | 8-HYDROXY-5-NITROQUINOLINE | MLS000069750 | SMR000059036 | cid_19910 | nitroxoline
TypeSmall organic molecule
Emp. Form.C9H6N2O3
Mol. Mass.190.1555
SMILESOc1ccc([N+]([O-])=O)c2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a