BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGuanine nucleotide-binding protein G(o), alpha subunit 1
LigandBDBM67701
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao with additional round of SAR compounds
EC50>30000±0 nM
Citation PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao with additional round of SAR compounds PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Guanine nucleotide-binding protein G(o), alpha subunit 1
Name:Guanine nucleotide-binding protein G(o), alpha subunit 1
Synonyms:guanine nucleotide-binding protein G(o) subunit alpha isoform a
Type:PROTEIN
Mol. Mass.:40043.59
Organism:Homo sapiens (Human)
Description:ChEMBL_321106
Residue:354
Sequence:
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67701
NameBDBM67701
Synonyms:3-chloranyl-6-methyl-N-(3-morpholin-4-ylpropyl)-1-benzothiophene-2-carboxamide | 3-chloro-6-methyl-N-(3-morpholin-4-ylpropyl)-1-benzothiophene-2-carboxamide | 3-chloro-6-methyl-N-(3-morpholinopropyl)benzothiophene-2-carboxamide | 3-chloro-6-methyl-N-[3-(4-morpholinyl)propyl]-1-benzothiophene-2-carboxamide | KSC-1-101c | KUC103874N | cid_3579902
TypeSmall organic molecule
Emp. Form.C17H21ClN2O2S
Mol. Mass.352.879
SMILESCc1ccc2c(Cl)c(sc2c1)C(=O)NCCCN1CCOCC1
Structure
n/a