BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA damage-inducible transcript 3 protein
LigandBDBM67759
Substrate/Competitorn/a
Meas. Tech.Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress
IC50>10000±n/a nM
Citation PubChem, PC Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress PubChem Bioassay(2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
DNA damage-inducible transcript 3 protein
Name:DNA damage-inducible transcript 3 protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:19175.17
Organism:Mus musculus
Description:gi_160707929
Residue:168
Sequence:
MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67759
NameBDBM67759
Synonyms:7-hexyl-1,3-dimethyl-8-[(3-methyl-1-piperidinyl)methyl]purine-2,6-dione | 7-hexyl-1,3-dimethyl-8-[(3-methylpiperidin-1-yl)methyl]-3,7-dihydro-1H-purine-2,6-dione | 7-hexyl-1,3-dimethyl-8-[(3-methylpiperidin-1-yl)methyl]purine-2,6-dione | 7-hexyl-1,3-dimethyl-8-[(3-methylpiperidino)methyl]xanthine | MLS000092221 | SMR000027121 | cid_3241736
TypeSmall organic molecule
Emp. Form.C20H33N5O2
Mol. Mass.375.5083
SMILESCCCCCCn1c(CN2CCCC(C)C2)nc2n(C)c(=O)n(C)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a