Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-hexosaminidase subunit alpha (HexA)
LigandBDBM68269
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition Assay
Temperature298.15±0 K
IC50 3.1e+4± 1.5e+4 nM
Citation Tropak, MBBlanchard, JEWithers, SGBrown, EDMahuran, D High-throughput screening for human lysosomal beta-N-Acetyl hexosaminidase inhibitors acting as pharmacological chaperones. Chem Biol14:153-64 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Beta-hexosaminidase subunit alpha (HexA)
Name:Beta-hexosaminidase subunit alpha (HexA)
Synonyms:Beta-N-acetylhexosaminidase subunit alpha | HEXA
Type:Protein
Mol. Mass.:60688.46
Organism:Homo sapiens (Human)
Description:P06865
Residue:529
Sequence:
MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSV
LDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTI
NDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHY
LPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVK
EVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF
MSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLL
DIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPW
YLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
AERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM68269
NameBDBM68269
Synonyms:M-31867
TypeSmall organic molecule
Emp. Form.C16H15NO3
Mol. Mass.269.2952
SMILESCC(O)CCN1C(=O)c2cccc3cccc(C1=O)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a