BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkanal monooxygenase alpha chain
LigandBDBM65980
Substrate/Competitorn/a
Meas. Tech.Absorbance Microorganism Dose Response to Identify Inhibitors of Vibrio harveyi
EC50>160000±n/a nM
Citation PubChem, PC Absorbance Microorganism Dose Response to Identify Inhibitors of Vibrio harveyi PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkanal monooxygenase alpha chain
Name:Alkanal monooxygenase alpha chain
Synonyms:Bacterial luciferase alpha chain
Type:Enzyme Catalytic Domain
Mol. Mass.:40139.12
Organism:Vibrio harveyi
Description:gi_126509
Residue:355
Sequence:
MKFGNFLLTYQPPELSQTEVMKRLVNLGKASEGCGFDTVWLLEHHFTEFGLLGNPYVAAA
HLLGATETLNVGTAAIVLPTAHPVRQAEDVNLLDQMSKGRFRFGICRGLYDKDFRVFGTD
MDNSRALMDCWYDLMKEGFNEGYIAADNEHIKFPKIQLNPSAYTQGGAPVYVVAESASTT
EWAAERGLPMILSWIINTHEKKAQLDLYNEVATEHGYDVTKIDHCLSYITSVDHDSNRAK
DICRNFLGHWYDSYVNATKIFDDSDQTKGYDFNKGQWRDFVLKGHKDTNRRIDYSYEINP
VGTPEECIAIIQQDIDATGIDNICCGFEANGSEEEIIASMKLFQSDVMPYLKEKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65980
NameBDBM65980
Synonyms:MLS001211346 | N-(5-Bromo-pyridin-2-yl)-4-ethyl-benzenesulfonamide | N-(5-bromanylpyridin-2-yl)-4-ethyl-benzenesulfonamide | N-(5-bromo-2-pyridinyl)-4-ethylbenzenesulfonamide | N-(5-bromo-2-pyridyl)-4-ethyl-benzenesulfonamide | N-(5-bromopyridin-2-yl)-4-ethylbenzenesulfonamide | SMR000516778 | cid_766689
TypeSmall organic molecule
Emp. Form.C13H13BrN2O2S
Mol. Mass.341.224
SMILESCCc1ccc(cc1)S(=O)(=O)Nc1ccc(Br)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a