BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome b-245 heavy chain
LigandBDBM42323
Substrate/Competitorn/a
Meas. Tech.Late stage results from the probe development effort to identify inhibitors of (NADPH oxidase 1) NOX1: Family selectivity: Set 2
IC50 5000±n/a nM
Citation PubChem, PC Late stage results from the probe development effort to identify inhibitors of (NADPH oxidase 1) NOX1: Family selectivity: Set 2 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cytochrome b-245 heavy chain
Name:Cytochrome b-245 heavy chain
Synonyms:CGD91-phox | Cytochrome b(558) subunit beta | Cytochrome b-245, beta polypeptide [Homo sapiens] | Cytochrome b558 subunit beta | Heme-binding membrane glycoprotein gp91phox | NADPH oxidase 2 | NADPH oxidase 2 (NOX2) | NOX2 | Neutrophil cytochrome b 91 kDa polypeptide | Superoxide-generating NADPH oxidase heavy chain subunit | gp91-1 | gp91-phox | p22 phagocyte B-cytochrome
Type:Enzyme
Mol. Mass.:65355.82
Organism:Homo sapiens (Human)
Description:P04839
Residue:570
Sequence:
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHN
ITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM42323
NameBDBM42323
Synonyms:1-(10H-phenothiazin-2-yl)ethanone | MLS000047624 | SMR000033635 | cid_81131
TypeSmall organic molecule
Emp. Form.C14H11NOS
Mol. Mass.241.308
SMILESCC(=O)c1ccc2Sc3ccccc3Nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a