BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-activated inward rectifier potassium channel 1
LigandBDBM36882
Substrate/Competitorn/a
Meas. Tech.Measurement of GPCR-mediated thallium flux through GIRK channels: Dose-Response with Rauwolscine
EC50 12640±n/a nM
Citation PubChem, PC Measurement of GPCR-mediated thallium flux through GIRK channels: Dose-Response with Rauwolscine PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G protein-activated inward rectifier potassium channel 1
Name:G protein-activated inward rectifier potassium channel 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:56581.73
Organism:Rattus norvegicus
Description:gi_13928834
Residue:501
Sequence:
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
PTRMEGNLPAKLRKMNSDRFT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36882
NameBDBM36882
Synonyms:3-(2,3-dihydro-1,4-benzodioxin-6-yl)-5,7-bis(oxidanyl)-2-(trifluoromethyl)chromen-4-one | 3-(2,3-dihydro-1,4-benzodioxin-6-yl)-5,7-dihydroxy-2-(trifluoromethyl)-1-benzopyran-4-one | 3-(2,3-dihydro-1,4-benzodioxin-6-yl)-5,7-dihydroxy-2-(trifluoromethyl)chromen-4-one | 3-(2,3-dihydro-1,4-benzodioxin-6-yl)-5,7-dihydroxy-2-(trifluoromethyl)chromone | MLS000038402 | SMR000035462 | cid_5389033
TypeSmall organic molecule
Emp. Form.C18H11F3O6
Mol. Mass.380.2715
SMILESOc1cc(O)c2c(c1)oc(c(-c1ccc3OCCOc3c1)c2=O)C(F)(F)F
Structure
n/a