BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-activated inward rectifier potassium channel 1
LigandBDBM73211
Substrate/Competitorn/a
Meas. Tech.Measurement of GPCR-mediated thallium flux through GIRK channels: Dose-Response with Rauwolscine
EC50 2288±n/a nM
Citation PubChem, PC Measurement of GPCR-mediated thallium flux through GIRK channels: Dose-Response with Rauwolscine PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G protein-activated inward rectifier potassium channel 1
Name:G protein-activated inward rectifier potassium channel 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:56581.73
Organism:Rattus norvegicus
Description:gi_13928834
Residue:501
Sequence:
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
PTRMEGNLPAKLRKMNSDRFT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM73211
NameBDBM73211
Synonyms:1-(5-ethylsulfanyl-1,3,4-thiadiazol-2-yl)-3-[1,1,1-trifluoro-2-(trifluoromethyl)butan-2-yl]urea | 1-(5-ethylsulfanyl-1,3,4-thiadiazol-2-yl)-3-[1,1,1-tris(fluoranyl)-2-(trifluoromethyl)butan-2-yl]urea | 1-[1,1-bis(trifluoromethyl)propyl]-3-[5-(ethylthio)-1,3,4-thiadiazol-2-yl]urea | 1-[5-(ethylthio)-1,3,4-thiadiazol-2-yl]-3-[1,1,1-trifluoro-2-(trifluoromethyl)butan-2-yl]urea | MLS000038682 | SMR000040744 | cid_659754
TypeSmall organic molecule
Emp. Form.C10H12F6N4OS2
Mol. Mass.382.349
SMILESCCSc1nnc(NC(=O)NC(CC)(C(F)(F)F)C(F)(F)F)s1
Structure
n/a