BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-activated inward rectifier potassium channel 1
LigandBDBM73212
Substrate/Competitorn/a
Meas. Tech.Measurement of GPCR-mediated thallium flux through GIRK channels: Dose-Response with Rauwolscine
EC50 41420±n/a nM
Citation PubChem, PC Measurement of GPCR-mediated thallium flux through GIRK channels: Dose-Response with Rauwolscine PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G protein-activated inward rectifier potassium channel 1
Name:G protein-activated inward rectifier potassium channel 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:56581.73
Organism:Rattus norvegicus
Description:gi_13928834
Residue:501
Sequence:
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
PTRMEGNLPAKLRKMNSDRFT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM73212
NameBDBM73212
Synonyms:4-[1-(tetrahydrofuryl)ethylcarbamoylamino]benzoic acid ethyl ester | 4-[[oxo-[1-(2-oxolanyl)ethylamino]methyl]amino]benzoic acid ethyl ester | MLS000063881 | SMR000076705 | cid_2955604 | ethyl 4-[({[1-(tetrahydro-2-furanyl)ethyl]amino}carbonyl)amino]benzoate | ethyl 4-[1-(oxolan-2-yl)ethylcarbamoylamino]benzoate
TypeSmall organic molecule
Emp. Form.C16H22N2O4
Mol. Mass.306.3569
SMILESCCOC(=O)c1ccc(NC(=O)NC(C)C2CCCO2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a