BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLANA
LigandBDBM74293
Substrate/Competitorn/a
Meas. Tech.Fluorescence Polarization Cell-Free Homogeneous Dose Retest to Confirm Inhibitors of the LANA Histone H2A/H2B Interaction
EC50>75000±n/a nM
Citation PubChem, PC Fluorescence Polarization Cell-Free Homogeneous Dose Retest to Confirm Inhibitors of the LANA Histone H2A/H2B Interaction PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
LANA
Name:LANA
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:131093.36
Organism:Human herpesvirus 8
Description:Q9QR71
Residue:1129
Sequence:
MAPPGMRLRSGRSTGAPLTRGSCRKRNRSPERCDLGDDLHLQPRRKHVADSVDGRECGPH
TLPIPGSPTVFTSGLPAFVSSPTLPVAPIPSPAPATPLPPPALLPPVTTSSSPIPPSHPV
SPGTTDTHSPSPALPPTQSPESSQRPPLSSPTGRPDSSTPMRPPPSQQTTPPHSPTTPPP
EPPSKSSPDSLAPSTLRSLRKRRLSSPQGPSTLNPICQSPPVSPPRCDFANRSVYPPWAT
ESPIYVGSSSDGDTPPRQPPTSPISIGSSSPSEGSWGDDTAMLVLLAEIAEEASKNEKEC
SENNQAGEDNGDNEISKESQVDKDDNDNKDDEEEQETDEEDEEDDEEDDEEDDEEDDEED
DEEDDEEDDEEEDEEEDEEEDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGD
GNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQRE
PQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQQE
PQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQD
EQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEE
QQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQQE
EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ
ELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQE
LEEVEEQEQEQEEQEEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQGVEQQEQETV
EEPIILHGSSSEDEMEVDYPVVSTHEQIASSPPGDNTPDDDPQPGPSREYRYVLRTSPPH
RPGVRMRRVPVTHPKKPHPRYQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQ
WKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSK
KVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQPGENQGPGDSPQEMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM74293
n/a
NameBDBM74293
Synonyms:MLS002181622 | N-[3-(2,3-dihydro-1,4-benzodioxin-3-ylmethylamino)-3-keto-propyl]-2-methoxy-benzamide | N-[3-(2,3-dihydro-1,4-benzodioxin-3-ylmethylamino)-3-oxidanylidene-propyl]-2-methoxy-benzamide | N-[3-(2,3-dihydro-1,4-benzodioxin-3-ylmethylamino)-3-oxopropyl]-2-methoxybenzamide | SMR001270652 | cid_25162247
TypeSmall organic molecule
Emp. Form.C20H22N2O5
Mol. Mass.370.3991
SMILESCOc1ccccc1C(=O)NCCC(=O)NCC1COc2ccccc2O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: