Reaction Details |
 | Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 3 |
---|
Ligand | BDBM47493 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Late-stage fluorescence-based dose-response cell-based assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 3 (S1P3) counterscreen assay |
---|
EC50 | >50000±n/a nM |
---|
Citation | PubChem, PC Late-stage fluorescence-based dose-response cell-based assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 3 (S1P3) counterscreen assay PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 3 |
---|
Name: | Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3 |
Synonyms: | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42278.13 |
Organism: | Homo sapiens (Human) |
Description: | Q99500 |
Residue: | 378 |
Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
BDBM47493 |
---|
Name | BDBM47493 |
Synonyms: | 3-[2-(2,4-dichlorophenoxy)ethoxy]-6-methyl-2-nitro-pyridine | 3-[2-(2,4-dichlorophenoxy)ethoxy]-6-methyl-2-nitropyridine | 3-[2-[2,4-bis(chloranyl)phenoxy]ethoxy]-6-methyl-2-nitro-pyridine | MLS000417155 | SMR000264378 | cid_4780551 |
Type | Small organic molecule |
Emp. Form. | C14H12Cl2N2O4 |
Mol. Mass. | 343.162 |
SMILES | Cc1ccc(OCCOc2ccc(Cl)cc2Cl)c(n1)[N+]([O-])=O |
Structure |
|
n/a |
---|