BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 3
LigandBDBM75603
Substrate/Competitorn/a
Meas. Tech.Late-stage fluorescence-based dose-response cell-based assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 3 (S1P3) counterscreen assay
EC50>50000±n/a nM
Citation PubChem, PC Late-stage fluorescence-based dose-response cell-based assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 3 (S1P3) counterscreen assay PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Sphingosine 1-phosphate receptor 3
Name:Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
Synonyms:EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42278.13
Organism:Homo sapiens (Human)
Description:Q99500
Residue:378
Sequence:
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM75603
NameBDBM75603
Synonyms:(5Z)-5-[[1-(2,6-difluorobenzyl)-2,5-dimethyl-pyrrol-3-yl]methylene]-3-methoxy-2-methylimino-thiazolidin-4-one | (5Z)-5-[[1-[(2,6-difluorophenyl)methyl]-2,5-dimethyl-3-pyrrolyl]methylidene]-3-methoxy-2-methylimino-4-thiazolidinone | (5Z)-5-[[1-[(2,6-difluorophenyl)methyl]-2,5-dimethylpyrrol-3-yl]methylidene]-3-methoxy-2-methylimino-1,3-thiazolidin-4-one | (5Z)-5-[[1-[[2,6-bis(fluoranyl)phenyl]methyl]-2,5-dimethyl-pyrrol-3-yl]methylidene]-3-methoxy-2-methylimino-1,3-thiazolidin-4-one | CYM50181 | SR-02000000305 | SR-02000000305-1 | cid_44620879
TypeSmall organic molecule
Emp. Form.C19H19F2N3O2S
Mol. Mass.391.435
SMILESCON1C(=O)\C(S\C1=N/C)=C\c1cc(C)n(Cc2c(F)cccc2F)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a