BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutathione transferase omega 1
LigandBDBM75773
Substrate/Competitorn/a
Meas. Tech.Late stage assay provider results from the probe development effort to identify inhibitors of GSTO1: Gel-based activity-based protein profiling (ABPP) IC50 Set 2
IC50 23±n/a nM
Citation PubChem, PC Late stage assay provider results from the probe development effort to identify inhibitors of GSTO1: Gel-based activity-based protein profiling (ABPP) IC50 Set 2 PubChem Bioassay(2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Glutathione transferase omega 1
Name:Glutathione transferase omega 1
Synonyms:GSTO 1-1 | Glutathione S-transferase omega-1 | glutathione S-transferase omega-1 isoform 1
Type:PROTEIN
Mol. Mass.:27565.54
Organism:Homo sapiens (Human)
Description:EBI_11172
Residue:241
Sequence:
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM75773
NameBDBM75773
Synonyms:N-[3-(N-(2-chloro-1-oxoethyl)-4-nitroanilino)propyl]-2,2,2-trifluoro-N-prop-2-ynylacetamide | N-[3-(N-(2-chloroacetyl)-4-nitro-anilino)propyl]-2,2,2-trifluoro-N-propargyl-acetamide | N-[3-(N-(2-chloroacetyl)-4-nitroanilino)propyl]-2,2,2-trifluoro-N-prop-2-ynylacetamide | N-[3-[2-chloranylethanoyl-(4-nitrophenyl)amino]propyl]-2,2,2-tris(fluoranyl)-N-prop-2-ynyl-ethanamide | SR-02000000385 | SR-02000000385-1 | cid_46245319
TypeSmall organic molecule
Emp. Form.C16H15ClF3N3O4
Mol. Mass.405.756
SMILES[O-][N+](=O)c1ccc(cc1)N(CCCN(CC#C)C(=O)C(F)(F)F)C(=O)CCl
Structure
n/a