BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAgp1p
LigandBDBM58019
Substrate/Competitorn/a
Meas. Tech.Confirmatory Cherry Pick 3 SAR Dose Response Multiplex in TOR pathway GFP-fusion proteins for Saccharomyes cerevisiae, specifically AGP1
EC50 774800±n/a nM
Citation PubChem, PC Confirmatory Cherry Pick 3 SAR Dose Response Multiplex in TOR pathway GFP-fusion proteins for Saccharomyes cerevisiae, specifically AGP1 PubChem Bioassay(2011)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Agp1p
Name:Agp1p
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:69674.09
Organism:Saccharomyces cerevisiae S288c
Description:gi_85666113
Residue:633
Sequence:
MSSSKSLYELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFF
DSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTI
QPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYS
NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVII
FYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDP
GAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFL
FLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMA
NSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFT
WLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILIL
IAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHR
QIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM58019
NameBDBM58019
Synonyms:5-methyl-N-(4-pyridin-2-yl-1,3-thiazol-2-yl)furan-2-carboxamide | 5-methyl-N-[4-(2-pyridinyl)-2-thiazolyl]-2-furancarboxamide | 5-methyl-N-[4-(2-pyridyl)thiazol-2-yl]-2-furamide | MLS001010722 | SMR000385065 | cid_2466262
TypeSmall organic molecule
Emp. Form.C14H11N3O2S
Mol. Mass.285.321
SMILESCc1ccc(o1)C(=O)Nc1nc(cs1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a