BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic cell protein-tyrosine phosphatase 70Z-PEP
LigandBDBM76338
Substrate/Competitorn/a
Meas. Tech.SAR LYP1 Fluorescent Assay using pCAP substrate for In Vitro dose response studies - Set 4
IC50 60800±n/a nM
Citation PubChem, PC SAR LYP1 Fluorescent Assay using pCAP substrate for In Vitro dose response studies - Set 4 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
Name:Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
Synonyms:3.1.3.48 | LyP | Lymphoid phosphatase | Lymphoid phosphatase (Lyp) | PEP | PEST-domain phosphatase | PTPN22 | PTPN8 | Tyrosine-protein phosphatase non-receptor type 22 | Tyrosine-protein phosphatase non-receptor type 22 (LYP) | tyrosine-protein phosphatase non-receptor type 22 isoform 1
Type:n/a
Mol. Mass.:91712.31
Organism:Homo sapiens (Human)
Description:Q9Y2R2
Residue:807
Sequence:
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTS
EPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM76338
NameBDBM76338
Synonyms:2-[4-[(E)-[[4-[2-(4-chloroanilino)thiazol-4-yl]benzoyl]hydrazono]methyl]phenoxy]acetic acid ethyl ester | 2-[4-[(E)-[[[4-[2-(4-chloroanilino)-4-thiazolyl]phenyl]-oxomethyl]hydrazinylidene]methyl]phenoxy]acetic acid ethyl ester | MLS-0437130.0001 | cid_46916210 | ethyl 2-[4-[(E)-[[4-[2-(4-chloroanilino)-1,3-thiazol-4-yl]benzoyl]hydrazinylidene]methyl]phenoxy]acetate | ethyl 2-[4-[(E)-[[4-[2-[(4-chlorophenyl)amino]-1,3-thiazol-4-yl]phenyl]carbonylhydrazinylidene]methyl]phenoxy]ethanoate
TypeSmall organic molecule
Emp. Form.C27H23ClN4O4S
Mol. Mass.535.014
SMILESCCOC(=O)COc1ccc(\C=N\NC(=O)c2ccc(cc2)-c2csc(Nc3ccc(Cl)cc3)n2)cc1
Structure
n/a