BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSUMO/sentrin specific peptidase family member 8
LigandBDBM76548
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 8 (SENP8) using a Luminescent assay
IC50>100000±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 8 (SENP8) using a Luminescent assay PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
SUMO/sentrin specific peptidase family member 8
Name:SUMO/sentrin specific peptidase family member 8
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:24104.52
Organism:Homo sapiens (Human)
Description:gi_262118306
Residue:212
Sequence:
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM76548
NameBDBM76548
Synonyms:4-(2-quinoxalinylamino)benzoic acid ethyl ester | 4-(quinoxalin-2-ylamino)benzoic acid ethyl ester | MLS000720674 | SMR000336417 | cid_1482857 | ethyl 4-(2-quinoxalinylamino)benzenecarboxylate | ethyl 4-(quinoxalin-2-ylamino)benzoate
TypeSmall organic molecule
Emp. Form.C17H15N3O2
Mol. Mass.293.3199
SMILESCCOC(=O)c1ccc(Nc2cnc3ccccc3n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a