BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSUMO-1-specific protease
LigandBDBM71415
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 6 (SENP6) using a Luminescent assay
IC50 2210±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 6 (SENP6) using a Luminescent assay PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
SUMO-1-specific protease
Name:SUMO-1-specific protease
Synonyms:Sentrin-specific protease 6 (SENP6)
Type:Enzyme Catalytic Domain
Mol. Mass.:126147.68
Organism:Homo sapiens (Human)
Description:Q9GZR1
Residue:1112
Sequence:
MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDE
DSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNMLSNNKKLSEN
TQNTSLCSGTVVHGRRFHHAHAQIPVVKTAAQSSLDRKERKEYPPHVQKVEINPVRLSRL
QGVERIMKKTEESESQVEPEIKRKVQQKRHCSTYQPTPPLSPASKKCLTHLEDLQRNCRQ
AITLNESTGPLLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPIDIIVNCDDSKHTYLQ
TNGKVILPGAKIPKITNLKERKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQPADSAC
SSPAPSTGKVEAALNENTCRAERELRSIPEDSELNTVTLPRKARMKDQFGNSIINTPLKR
RKVFSQEPPDALALSCQSSFDSVILNCRSIRVGTLFRLLIEPVIFCLDFIKIQLDEPDHD
PVEIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKLSIQLQMNKEDKVWNDCKGVNKLT
NLEEQYIILIFQNGLDPPANMVFESIINEIGIKNNISNFFAKIPFEEANGRLVACTRTYE
ESIKGSCGQKENKIKTVSFESKIQLRSKQEFQFFDEEEETGENHTIFIGPVEKLIVYPPP
PAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQ
RERRNHETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCFPGLEKPK
YEPNPHYHENAVIQKCSTVEDSCISSSASEMESCSQNSSAKPVIKKMLNKKHCIAVIDSN
PGQEESDPRYKRNICSVKYSVKKINHTASENEEFNKGESTSQKVADRTKSENGLQNESLS
STHHTDGLSKIRLNYSDESPEAGKMLEDELVDFSEDQDNQDDSSDDGFLADDNCSSEIGQ
WHLKPTICKQPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGSKRSFSKDVMKGSNPK
VPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQE
DQSKEKRKHKDTYSTEAPLGEGTEQYVNSISD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM71415
NameBDBM71415
Synonyms:3-(N-ethylanilino)-2H-isoquinolin-1-one | 3-(N-ethylanilino)isocarbostyril | 3-[ethyl(phenyl)amino]-2H-isoquinolin-1-one | MLS001167171 | SMR000641033 | cid_4461971
TypeSmall organic molecule
Emp. Form.C17H16N2O
Mol. Mass.264.3217
SMILESCCN(c1ccccc1)c1cc2ccccc2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a