BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetX-linked inhibitor of apoptosis protein (XIAP)
LigandBDBM44286
Substrate/Competitorn/a
Meas. Tech.SAR analysis of Antagonists of XIAP-Bir3 domain of IAP-family anti-apoptotic proteins - Set 2
IC50 137175±n/a nM
Citation PubChem, PC SAR analysis of Antagonists of XIAP-Bir3 domain of IAP-family anti-apoptotic proteins - Set 2 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
X-linked inhibitor of apoptosis protein (XIAP)
Name:X-linked inhibitor of apoptosis protein (XIAP)
Synonyms:E3 ubiquitin-protein ligase XIAP | Inhibitor of apoptosis protein 3 | Inhibitor of apoptosis protein 3 (XIAP) | X-linked inhibitor of apoptosis
Type:Protein
Mol. Mass.:56685.27
Organism:Homo sapiens (Human)
Description:P98170
Residue:497
Sequence:
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM44286
NameBDBM44286
Synonyms:(2S)-N-[(1S)-2-keto-1-methyl-2-(1-naphthylamino)ethyl]-3-methyl-2-[[(2S)-2-(methylamino)propanoyl]amino]butyramide;2,2,2-trifluoroacetic acid | CHEMBL1616141 | ML183 | MLS-0412053.0001 | cid_44176340 | formic acid;(2S)-3-methyl-2-[[(2S)-2-(methylamino)-1-oxopropyl]amino]-N-[(2S)-1-(1-naphthalenylamino)-1-oxopropan-2-yl]butanamide | formic acid;(2S)-3-methyl-2-[[(2S)-2-(methylamino)propanoyl]amino]-N-[(2S)-1-(naphthalen-1-ylamino)-1-oxopropan-2-yl]butanamide | formic acid;(2S)-N-[(1S)-2-keto-1-methyl-2-(1-naphthylamino)ethyl]-3-methyl-2-[[(2S)-2-(methylamino)propanoyl]amino]butyramide | methanoic acid;(2S)-3-methyl-2-[[(2S)-2-(methylamino)propanoyl]amino]-N-[(2S)-1-(naphthalen-1-ylamino)-1-oxidanylidene-propan-2-yl]butanamide
TypeSmall organic molecule
Emp. Form.C22H30N4O3
Mol. Mass.398.4986
SMILESCN[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)Nc1cccc2ccccc12
Structure
n/a