Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 4
LigandBDBM81377
Substrate/Competitorn/a
Meas. Tech.In Vitro Activity Kinase Assay
IC50 189±0.0 nM
Kd 120±0.0 nM
Citation Zhou, WHur, WMcDermott, UDutt, AXian, WFicarro, SBZhang, JSharma, SVBrugge, JMeyerson, MSettleman, JGray, NS A structure-guided approach to creating covalent FGFR inhibitors. Chem Biol17:285-95 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 4
Name:Fibroblast growth factor receptor 4
Synonyms:CD_antigen: CD334 FGFR4 | FGFR-4 | Fibroblast growth factor receptor 4 (FGFR4) | JK2 | TKF
Type:Protein
Mol. Mass.:87957.45
Organism:Homo sapiens (Human)
Description:P22455
Residue:802
Sequence:
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81377
NameBDBM81377
Synonyms:FIIN-1
TypeSmall organic molecule
Emp. Form.C30H35Cl2N7O4
Mol. Mass.628.549
SMILESCCNCCCCNc1ncc2CN(C(=O)N(Cc3cccc(NC(=O)C=C)c3)c2n1)c1c(Cl)c(OC)cc(OC)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a