Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucyl-cystinyl aminopeptidase
LigandBDBM271280
Substrate/Competitorn/a
Meas. Tech.Inhibition of Human P-LAP (hP-LAP) Assay
IC50 1.50±n/a nM
Citation Kawaguchi, KIshihata, AInagaki, YTsuchiya, KHanadate, TKanai, AKaizawa, HKazami, JMorikawa, HHiramoto, MEnjo, KTakamatsu, H Pyridine derivative US Patent US10059720 Publication Date 8/28/2018
More Info.:Get all data from this article,  Assay Method
 
Leucyl-cystinyl aminopeptidase
Name:Aminopeptidase
Synonyms:Cystinyl aminopeptidase | IRAP | Insulin-regulated membrane aminopeptidase | Insulin-responsive aminopeptidase | Leucyl-cystinyl aminopeptidase, pregnancy serum form | OTase | Oxytocinase | P-LAP | Placental leucine aminopeptidase
Type:PROTEIN
Mol. Mass.:117334.10
Organism:Homo sapiens (Human)
Description:ChEMBL_1473494
Residue:1025
Sequence:
MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVV
AVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELS
LHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYH
GQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAAR
SAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVA
FIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWW
NDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQI
EEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQT
LDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVT
EGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINP
YVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLE
KLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASS
EDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGS
YTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKS
LTWWL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM271280
NameBDBM271280
Synonyms:US10059720, Example 95
TypeSmall organic molecule
Emp. Form.C19H26N2O4S
Mol. Mass.378.486
SMILESCC(C)C[C@H](N)[C@](O)(Cc1cc(OCCc2ccsc2)ccn1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a