Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50005118
Substrate/Competitorn/a
Ki 26±n/a nM
CommentsPDSP_1584
Citation Hall, HSällemark, MJerning, E Effects of remoxipride and some related new substituted salicylamides on rat brain receptors. Acta Pharmacol Toxicol (Copenh)58:61-70 (1986) [PubMed]
More Info.:Get all data from this article
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005118
NameBDBM50005118
Synonyms:(S)-3,5-Dichloro-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide | (S)-3,5-dichloro-N-((1-ethylpyrrolidin-2-yl)methyl)-2-hydroxy-6-methoxybenzamide | (S)3,5-Dichloro-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide | 3,5-Dichloro-N-((S)-1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide | 3,5-Dichloro-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide | 3,5-Dichloro-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide (raclopride) | 3,5-Dichloro-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide(Raclopride) | CHEMBL8809 | RACLOPRIDE | Raclopride;3,5-Dichloro-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide
TypeSmall organic molecule
Emp. Form.C15H20Cl2N2O3
Mol. Mass.347.237
SMILESCCN1CCC[C@H]1CNC(=O)c1c(O)c(Cl)cc(Cl)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a