Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM21397
Substrate/Competitorn/a
Ki 0.32±n/a nM
CommentsPDSP_1742
Citation Boyajian, CLLeslie, FM Pharmacological evidence for alpha-2 adrenoceptor heterogeneity: differential binding properties of [3H]rauwolscine and [3H]idazoxan in rat brain. J Pharmacol Exp Ther241:1092-8 (1987) [PubMed]
More Info.:Get all data from this article
 
adrenergic Alpha2
Name:Adrenergic receptor alpha
Synonyms:Alpha-2C adrenergic receptor | adrenergic Alpha2C
Type:Enzyme Catalytic Domain
Mol. Mass.:49890.50
Organism:RAT
Description:adrenergic Alpha2 0 RAT::P22086
Residue:458
Sequence:
MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWGPPPGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRR
GGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRAR
SSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFW
IGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21397
NameBDBM21397
Synonyms:8-[4-(4-fluorophenyl)-4-keto-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxidanylidene-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxobutyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL267930 | MLS000028615 | SMR000058674 | SPIPERONE | Spiroperidol | US9359372, Spiperone | [3H]-Spiroperidol | cid_5265
Typeradiolabeled ligand
Emp. Form.C23H26FN3O2
Mol. Mass.395.4698
SMILESFc1ccc(cc1)C(=O)CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1
Structure
n/a