Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGDR
LigandBDBM82215
Substrate/Competitorn/a
Ki 3537±n/a nM
CommentsPDSP_5296
Citation Shimizu, TYamashita, AHayaishi, O Specific binding of prostaglandin D2 to rat brain synaptic membrane. Occurrence, properties, and distribution. J Biol Chem257:13570-5 (1982) [PubMed]
More Info.:Get all data from this article
 
PTGDR
Name:PTGDR
Synonyms:Prostaglandin D2 | Prostaglandin D2 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39786.91
Organism:RAT
Description:Prostaglandin D2 PTGDR RAT::Q9R261
Residue:357
Sequence:
MNESYRCQAATWVERGSSATMGGVAFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF
YVLVCGLTVTDLLGKCLISPMVLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTL
QLLAMALECWLSLGHPFFYQRHITARRGVLVAPVAGAFSLAFCALPFAGFGKFVQYCPGT
WCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRRQRHHPRRCSR
DRAQSGSDYRHGSPNPLEELDHFVLLALTTVLFTMCSLPLIYRAYYGAFKLVDRADGDSE
DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKTFTRPLIYRNWCSHSWQTNMESTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82215
NameBDBM82215
Synonyms:CAS_35121-78-9 | NSC_5282411 | PGI2
TypeSmall organic molecule
Emp. Form.C20H32O5
Mol. Mass.352.4651
SMILESCCCCCC(O)C=CC1C(O)CC2OC(CC12)=CCCCC(O)=O |w:7.6,18.20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a