Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR7
LigandBDBM50005835
Substrate/Competitorn/a
Ki 251.18±n/a nM
CommentsPDSP_1788
Citation Tsou, APKosaka, ABach, CZuppan, PYee, CTom, LAlvarez, RRamsey, SBonhaus, DWStefanich, E Cloning and expression of a 5-hydroxytryptamine7 receptor positively coupled to adenylyl cyclase. J Neurochem63:456-64 (1994) [PubMed]
More Info.:Get all data from this article
 
HTR7
Name:HTR7
Synonyms:5-HT7 | 5-HT7L | Serotonin 7 (5-HT7) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:49632.36
Organism:GUINEA PIG
Description:5-HT7 HTR7 GUINEA PIG::P50407
Residue:446
Sequence:
MMGVNSSGRPDLYGHLHSILLPGRGLPDWSPDGGADPGVSTWTPRLLSGVPEVAASPSPS
WDGTWDNVSGCGEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYL
IVSLALADLSVAVAVIPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISID
RYLGITRPLTYPVRQNGKCMPKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGY
TIYSTAVAFYIPMSVMLFMYYRIYKAARKSAAKHKFPGFPRVQPESIISLNGMVKLQKEV
EECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTACS
CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEAL
KLAERPERPECVLQNSDYCRKKGHDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005835
NameBDBM50005835
Synonyms:(3-[2-(dimethylamino)ethyl]-1H-indol-5-yl)-N-methylmethanesulfonamide | 1-[3-(2-dimethylaminoethyl)-1H-indol-5-yl]-N-methyl-methanesulfonamide | 1-{3-[2-(dimethylamino)ethyl]-1H-indol-5-yl}-N-methylmethanesulfonamide | 3-(2-(dimethylamino)ethyl)-N-methyl-1H-indole-5-methanesulfonamide | 3-[2-(dimethylamino)ethyl]-N-methylindole-5-methanesulfonamide | CHEMBL128 | SUMATRIPTAN | Sumatran | Sumax
TypeSmall organic molecule
Emp. Form.C14H21N3O2S
Mol. Mass.295.4
SMILESCNS(=O)(=O)Cc1ccc2[nH]cc(CCN(C)C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a