Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAGTR1
LigandBDBM82273
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1621
Citation Hegde, SSBonhaus, DWJohnson, LGLeung, EClark, RDEglen, RM RS 39604: a potent, selective and orally active 5-HT4 receptor antagonist. Br J Pharmacol115:1087-95 (1995) [PubMed]  Article
More Info.:Get all data from this article
 
AGTR1
Name:AGTR1
Synonyms:ANGIOTENSIN AT1 | Agtr1.2 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:40518.13
Organism:Xenopus tropicalis
Description:B3DLC0
Residue:355
Sequence:
MLSNVSTGEVKCARSGMHNYIFITIPIIYSTIFVVGVFGNSLVVIVIYSYMKMKTVASIF
LMNLALSDLCFVITLPLWAAYTAMHYHWPFGDFLCKLASTAITLNLYTTVFLLTCLSIDR
YTAIVHPMKSRIRRTVMVARLTCVGIWVVAFLASLPSIIYRQIYIFPGTNQTVCALVYQS
GQIYFTIGMSLVKNIVGFFIPFLIILTSYTLIGKTLKEVCRAQRARNDDIFKMIVAVVLL
FFFCWIPHQVFTFLDVLIQMDVIQNCKIYDIVDTGMPITICIAYFNSCLNPFLYGFFGKN
FRKHFLQLIKYLPPKMRSHASVSTKMSTASQRLSDTKYASNKISLQMTDKEEHCK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82273
NameBDBM82273
Synonyms:CAS_167710-87-4 | RS 39604
TypeSmall organic molecule
Emp. Form.C26H36ClN3O6S
Mol. Mass.554.099
SMILESCOc1cc(COc2cc(N)c(Cl)cc2C(=O)CCC2CCN(CCNS(C)(=O)=O)CC2)cc(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a