Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin B
LigandBDBM82304
Substrate/Competitorn/a
Ki 489±n/a nM
CommentsPDSP_2315
Citation Gully, DFréhel, DMarcy, CSpinazzá, ALespy, LNeliat, GMaffrand, JPLe Fur, G Peripheral biological activity of SR 27897: a new potent non-peptide antagonist of CCKA receptors. Eur J Pharmacol232:13-9 (1993) [PubMed]
More Info.:Get all data from this article
 
Cholecystokinin B
Name:Cholecystokinin B
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:12528.64
Organism:GUINEA PIG
Description:Cholecystokinin B 0 GUINEA PIG::P01356
Residue:114
Sequence:
MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGAL
LARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82304
NameBDBM82304
Synonyms:CAS_122077 | NSC_122077 | SR 27897
TypeSmall organic molecule
Emp. Form.C20H14ClN3O3S
Mol. Mass.411.861
SMILESOC(=O)Cn1c(cc2ccccc12)C(=O)Nc1nc(cs1)-c1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a