Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin B
LigandBDBM21147
Substrate/Competitorn/a
Ki 1.1±n/a nM
CommentsPDSP_2196
Citation Pendley, CEFitzpatrick, LRCapolino, AJDavis, MAEsterline, NJJakubowska, ABertrand, PGuyon, CDubroeucq, MCMartin, GE RP 73870, a gastrin/cholecystokinin-B receptor antagonist with potent anti-ulcer activity in the rat. J Pharmacol Exp Ther273:1015-22 (1995) [PubMed]
More Info.:Get all data from this article
 
Cholecystokinin B
Name:Cholecystokinin B
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:12528.64
Organism:GUINEA PIG
Description:Cholecystokinin B 0 GUINEA PIG::P01356
Residue:114
Sequence:
MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGAL
LARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21147
NameBDBM21147
Synonyms:(3S)-3-[(2S)-2-[(2S)-2-{2-[(2S)-2-[(2S)-2-[(3S)-3-amino-3-formamidopropanoic acid]-3-[4-(sulfooxy)phenyl]propanamido]-4-(methylsulfanyl)butanamido]acetamido}-3-(1H-indol-3-yl)propanamido]-4-(methylsulfanyl)butanamido]-3-{[(1S)-1-carbamoyl-2-phenylethyl]carbamoyl}propanoic acid | CCK-8 | CCK-8(SO3) | CHEMBL1121 | H-Asp-Tyr(SO3H)-Met-Gly-Trp-Met-Asp-Phe-NH2 | SINCALIDE | Syncalide | [125I]CCK-8
Typeradiolabeled ligand
Emp. Form.C49H62N10O16S3
Mol. Mass.1143.269
SMILESCSCC[C@H](NC(=O)[C@H](Cc1ccc(OS(O)(=O)=O)cc1)NC(=O)[C@@H](N)CC(O)=O)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a