Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin B
LigandBDBM82404
Substrate/Competitorn/a
Ki 0.8±n/a nM
CommentsPDSP_2242
Citation Pendley, CEFitzpatrick, LRCapolino, AJDavis, MAEsterline, NJJakubowska, ABertrand, PGuyon, CDubroeucq, MCMartin, GE RP 73870, a gastrin/cholecystokinin-B receptor antagonist with potent anti-ulcer activity in the rat. J Pharmacol Exp Ther273:1015-22 (1995) [PubMed]
More Info.:Get all data from this article
 
Cholecystokinin B
Name:Cholecystokinin B
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:12528.64
Organism:GUINEA PIG
Description:Cholecystokinin B 0 GUINEA PIG::P01356
Residue:114
Sequence:
MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGAL
LARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82404
NameBDBM82404
Synonyms:Glycinamide,N-[[[3-(2-sulfoethyl)phenyl]amino]carbonyl]glycyl-N2-(3-methoxyphenyl)-N-methyl-N-phenyl-(9CI) | RP 73870
Typen/a
Emp. Form.C26H27N3O7S
Mol. Mass.525.573
SMILESCOc1cccc(c1)N(C(=O)CNC(=O)c1cccc(CCS(O)(=O)=O)c1)C(=O)N(C)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a