Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha1
LigandBDBM81444
Substrate/Competitorn/a
Ki 0.63±n/a nM
CommentsPDSP_1955
Citation Schwinn, DAJohnston, GIPage, SOMosley, MJWilson, KHWorman, NPCampbell, SFidock, MDFurness, LMParry-Smith, DJ Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther272:134-42 (1995) [PubMed]
More Info.:Get all data from this article
 
adrenergic Alpha1
Name:adrenergic Alpha1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:62499.05
Organism:BOVINE
Description:adrenergic Alpha1 0 BOVINE::A7MBE0
Residue:563
Sequence:
MLTVDDVLEQVGEFGWFQKQTFLILCLLSAAFAPIYVGIVFLAFTPDHRCRSPGVAELSR
RCGWSLAEELNYTVPGPGPESQCLRYEVDWNQSTLGCLDPLASLATNGSPLPLGPCEQGW
VYDTPGSSIVTEFNLVCDDSWKVDLFQSCVNLGFFLGSLGVGYIADRFGRKVCLLATTLT
CASLGVLTAVAPDYTSLLIFRLLQGLVSKGSWTAGYTLITEFVGLGYRRTVAILYQMAFT
VGLVLLSGLAYILPHWRWLQLAVSLPIFLLLFRFWFVPESPRWLLSQKRNTEAIKIMDHI
AQKNGKLPPADLKMLSLEEDVTEKLSPSFIDLFRTPNLRKYTFILMYLWFTSSVVYQGLI
MHVGATGGNLYLDFLYSALVEFPAGFIILVTIDRFGRRYPLATSNLAAGLACFLMIFIPH
DLPWLNIMVACVGRMGITIVFQMVCLVNAELFPTFIRNLGMMVCSSLCDLGGVLTPFLVF
RLMEVWQGSPLILFAALGLVAGGMTLLLPETKGVTLPETIEDAENLQRKAKPKENKIYLQ
VQTSELNTQAAERDASQGTAQQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81444
NameBDBM81444
Synonyms:CAS_185453 | NSC_185453 | WB 4101 | WB-4101
TypeSmall organic molecule
Emp. Form.C25H27NO5
Mol. Mass.421.4856
SMILESCOc1cccc(OC)c1OCCNCC1Oc2ccccc2OC1c1ccccc1
Structure
n/a