Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2c (5HT2A and 5HT2C)
LigandBDBM79181
Substrate/Competitorn/a
Ki 100±n/a nM
CommentsPDSP_1908
Citation Roth, BLCraigo, SCChoudhary, MSUluer, AMonsma, FJShen, YMeltzer, HYSibley, DR Binding of typical and atypical antipsychotic agents to 5-hydroxytryptamine-6 and 5-hydroxytryptamine-7 receptors. J Pharmacol Exp Ther268:1403-10 (1994) [PubMed]
More Info.:Get all data from this article
 
Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Name:Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | 5-hydroxytryptamine receptor 2C (5HT2c) | HTR2C
Type:Enzyme
Mol. Mass.:51935.10
Organism:Rattus norvegicus (Rat)
Description:P08909
Residue:460
Sequence:
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79181
NameBDBM79181
Synonyms:10-[3-(4-methyl-1-piperazinyl)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | 10-[3-(4-methylpiperazin-1-yl)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | 10-[3-(4-methylpiperazino)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | MLS001146870 | SMR000059133 | TRIFLUOPERAZINE | TRIFLUOPERAZINE DIHYDROCHLORIDE | Trifluperazine | cid_2913535 | cid_5566
TypeSmall organic molecule
Emp. Form.C21H24F3N3S
Mol. Mass.407.496
SMILESCN1CCN(CCCN2c3ccccc3Sc3ccc(cc23)C(F)(F)F)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a