Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50017721
Substrate/Competitorn/a
Ki 0.06±n/a nM
CommentsPDSP_606
Citation Moguilevsky, NVarsalona, FNoyer, MGillard, MGuillaume, JPGarcia, LSzpirer, CSzpirer, JBollen, A Stable expression of human H1-histamine-receptor cDNA in Chinese hamster ovary cells. Pharmacological characterisation of the protein, tissue distribution of messenger RNA and chromosomal localisation of the gene. Eur J Biochem224:489-95 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:H1R | HH1R | HISTAMINE H1 | HRH1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:55808.72
Organism:Homo sapiens (Human)
Description:Cell pellets from SK-N-MC cells transfected with human H1 receptor were used in binding assay.
Residue:487
Sequence:
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017721
NameBDBM50017721
Synonyms:1-Methyl-4-(5H-dibenzo(a,d)cycloheptenylidene)piperidine | 1-methyl-4-(5-dibenzo(a,e)cycloheptatrienylidene)piperidine | 4-(5-dibenzo(a,d)cyclohepten-5-ylidine)-1-methylpiperidine | 4-(5H-dibenzo(a,d)cyclohepten-5-ylidene)-1-methylpiperidine | 4-(5H-dibenzo[a,d][7]annulen-5-ylidene)-1-methylpiperidine4-(5H-dibenzo[a,d]cyclohepten-5-ylidene)-1-methylpiperidine | 5-(1-methylpiperidylidene-4)-5H-dibenzo(a,d)cyclopheptene | CHEMBL516 | CYPROHEPTADINE
TypeSmall organic molecule
Emp. Form.C21H21N
Mol. Mass.287.3981
SMILES[#6]-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1/c2ccccc2-[#6]=[#6]-c2ccccc-12 |c:16|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a