Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM50020192
Substrate/Competitorn/a
Ki 3.36±n/a nM
CommentsPDSP_1743
Citation O'Rourke, MFIversen, LJLomasney, JWBylund, DB Species orthologs of the alpha-2A adrenergic receptor: the pharmacological properties of the bovine and rat receptors differ from the human and porcine receptors. J Pharmacol Exp Ther271:735-40 (1994) [PubMed]
More Info.:Get all data from this article
 
adrenergic Alpha2
Name:adrenergic Alpha2
Synonyms:Alpha-2A adrenergic receptor | adrenergic Alpha2A
Type:Enzyme Catalytic Domain
Mol. Mass.:48998.96
Organism:PIG
Description:adrenergic Alpha2 0 PIG::P18871
Residue:450
Sequence:
MGSLQPEAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKAGGGG
QQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAAA
ALPGGAERRPNGLGPERGVGRVGAEAEPLPVQLNGAPGEPAPAGPRDADGLDLEESSSSE
HAERPPGPRRSERGPRAKSKARASQVKPGDSLPRRGPGAPGPGAPATGAGEERGGVAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020192
NameBDBM50020192
Synonyms:8-(2,3-Dihydro-benzo[1,4]dioxin-2-ylmethyl)-1-phenyl-1,3,8-triaza-spiro[4.5]decan-4-one | CHEMBL300555 | Spiroxatrine
TypeSmall organic molecule
Emp. Form.C22H25N3O3
Mol. Mass.379.4522
SMILESO=C1NCN(c2ccccc2)C11CCN(CC2COc3ccccc3O2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a