Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin B
LigandBDBM50040671
Substrate/Competitorn/a
Ki 0.1±n/a nM
CommentsPDSP_2244
Citation Patel, SSmith, AJChapman, KLFletcher, AEKemp, JAMarshall, GRHargreaves, RJRyecroft, WIversen, LLIversen, SD Biological properties of the benzodiazepine amidine derivative L-740,093, a cholecystokinin-B/gastrin receptor antagonist with high affinity in vitro and high potency in vivo. Mol Pharmacol46:943-8 (1994) [PubMed]
More Info.:Get all data from this article
 
Cholecystokinin B
Name:Cholecystokinin B
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:12528.64
Organism:GUINEA PIG
Description:Cholecystokinin B 0 GUINEA PIG::P01356
Residue:114
Sequence:
MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGAL
LARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040671
NameBDBM50040671
Synonyms:1-[5-(3-Aza-bicyclo[3.2.2]non-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl]-3-m-tolyl-urea | CHEMBL349291 | L-740,093
TypeSmall organic molecule
Emp. Form.C26H31N5O2
Mol. Mass.445.5566
SMILESCN1c2ccccc2C(=NC(NC(=O)Nc2cccc(C)c2)C1=O)N1CC2CCC(CC2)C1 |c:9,(7.22,-6.97,;7.67,-8.45,;6.69,-9.39,;5.36,-8.63,;4.02,-9.39,;4.02,-10.93,;5.36,-11.69,;6.71,-10.96,;7.63,-11.85,;9.14,-11.6,;9.86,-10.19,;11.4,-10.21,;12.13,-11.53,;11.35,-12.86,;13.67,-11.57,;14.48,-10.26,;13.72,-8.91,;14.5,-7.6,;16.04,-7.62,;16.81,-8.95,;18.33,-8.98,;16.01,-10.29,;9.18,-8.72,;10.1,-7.49,;7.17,-13.34,;5.55,-13.5,;4.73,-14.54,;5.14,-16.05,;6.65,-16.64,;8.09,-15.8,;7.22,-14.74,;6.1,-14.2,;8.22,-14.23,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a