Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B
LigandBDBM21392
Substrate/Competitorn/a
Ki 0.25±n/a nM
CommentsPDSP_140
Citation Boess, FGMartin, IL Molecular biology of 5-HT receptors. Neuropharmacology33:275-317[PubMed]
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 1B
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | S12 | Serotonin 1D beta receptor | Serotonin Receptor 1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:43579.17
Organism:Homo sapiens (human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells
Residue:390
Sequence:
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21392
NameBDBM21392
Synonyms:3-(2-aminoethyl)-1H-indole-5-carboxamide | 5-CT | 5-CT,DP | 5-carboxamidotryptamine | CHEMBL1256863 | CHEMBL18840 | [3H]-5-CT | [3H]-5-Carboxamide tryptamine | [3H]-5-Carboxyamidotryptamine | [3H]-5-carboxamidotryptamine
TypeSmall organic molecule
Emp. Form.C11H13N3O
Mol. Mass.203.2404
SMILESNCCc1c[nH]c2ccc(cc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a