Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1D
LigandBDBM50280055
Substrate/Competitorn/a
Ki 0.06±n/a nM
CommentsPDSP_651
Citation Boess, FGMartin, IL Molecular biology of 5-HT receptors. Neuropharmacology33:275-317[PubMed]
More Info.:Get all data from this article
 
HTR1D
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1D | 5-HT1D | 5-hydroxytryptamine receptor 1D | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41551.75
Organism:RAT
Description:5-HT1D HTR1D RAT::P28565
Residue:374
Sequence:
MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTI
LLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCT
ASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLFWRQATAHE
EMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQ
LITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTL
GIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDF
RQAFQRVVHFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280055
NameBDBM50280055
Synonyms:50285557 | 7-Methyl-4,6,6a,7,8,9,10,10a-octahydro-indolo[4,3-fg]quinoline-9-carboxylic acid ((2R,5S,10bS)-5-benzyl-10b-hydroxy-2-methyl-3,6-dioxo-octahydro-oxazolo[3,2-a]pyrrolo[2,1-c]pyrazin-2-yl)-amide | DHE
TypeSmall organic molecule
Emp. Form.C33H37N5O5
Mol. Mass.583.6774
SMILESCN1CC(CC2C1Cc1c[nH]c3cccc2c13)C(=O)N[C@]1(C)O[C@@]2(O)C3CCCN3C(=O)[C@H](Cc3ccccc3)N2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a