Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1F
LigandBDBM50031942
Substrate/Competitorn/a
Ki 6.3±n/a nM
CommentsPDSP_1230
Citation Boess, FGMartin, IL Molecular biology of 5-HT receptors. Neuropharmacology33:275-317[PubMed]
More Info.:Get all data from this article
 
HTR1F
Name:HTR1F
Synonyms:5-HT1F | 5-hydroxytryptamine receptor 1F
Type:Enzyme Catalytic Domain
Mol. Mass.:41993.14
Organism:MOUSE
Description:5-HT1F HTR1F MOUSE::Q02284
Residue:366
Sequence:
MDFLNASDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALD
RYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFWRHQGTSRDDECVIKHDHIV
STIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIKEELNGQVFLESGEKSIKL
VSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031942
n/a
NameBDBM50031942
Synonyms:(6aR,9R)-4,6a,7-Trimethyl-4,6,6a,7,8,9-hexahydro-indolo[4,3-fg]quinoline-9-carboxylic acid (1-hydroxymethyl-propyl)-amide | (6aR,9R)-4,7-Dimethyl-4,6,6a,7,8,9-hexahydro-indolo[4,3-fg]quinoline-9-carboxylic acid ((S)-1-hydroxymethyl-propyl)-amide | (6aR,9R)-4-Methyl-4,6,6a,7,8,9-hexahydro-indolo[4,3-fg]quinoline-9-carboxylic acid (1-hydroxymethyl-propyl)-amide | (6aR,9R)-5,7-Dimethyl-4,6,6a,7,8,9-hexahydro-indolo[4,3-fg]quinoline-9-carboxylic acid diethylamide | (methylsergide)4,7-Dimethyl-4,6,6a,7,8,9-hexahydro-indolo[4,3-fg]quinoline-9-carboxylic acid (1-hydroxymethyl-propyl)-amide | 4,7-Dimethyl-4,6,6a,7,8,9-hexahydro-indolo[4,3-fg]quinoline-9-carboxylic acid (1-hydroxymethyl-propyl)-amide | CHEMBL1065 | METHYSERGIDE | Sansert
TypeSmall organic molecule
Emp. Form.C21H27N3O2
Mol. Mass.353.458
SMILESCC[C@@H](CO)NC(=O)[C@H]1CN(C)[C@@H]2Cc3cn(C)c4cccc(C2=C1)c34 |r,c:24|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: