BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta lactamase
LigandBDBM83276
Substrate/Competitorn/a
Meas. Tech.Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA)
IC50>49760±n/a nM
Citation PubChem, PC Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA) PubChem Bioassay(2011)[AID]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta lactamase
Name:Beta lactamase
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:31513.38
Organism:Pseudomonas aeruginosa
Description:gi_114881106
Residue:286
Sequence:
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM83276
NameBDBM83276
Synonyms:MLS002702141 | SMR001565706 | [(1E,3E)-4-(benzenesulfonyl)buta-1,3-dienyl]sulfonylbenzene | [(1E,3E)-4-(phenylsulfonyl)buta-1,3-dienyl]sulfonylbenzene | [(1E,3E)-4-besylbuta-1,3-dienyl]sulfonylbenzene | cid_5468033
TypeSmall organic molecule
Emp. Form.C16H14O4S2
Mol. Mass.334.41
SMILESO=S(=O)(\C=C\C=C\S(=O)(=O)c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a