BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptotic peptidase activating factor 1
LigandBDBM32033
Substrate/Competitorn/a
Meas. Tech.Dose Response validation of Inhibitors of Apaf-1 using a Fluorescent Interference Counterscreen assay
IC50>100000±0 nM
Citation PubChem, PC Dose Response validation of Inhibitors of Apaf-1 using a Fluorescent Interference Counterscreen assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,  Assay Method
 
Apoptotic peptidase activating factor 1
Name:Apoptotic peptidase activating factor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:141834.40
Organism:Homo sapiens
Description:O14727
Residue:1248
Sequence:
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS
INVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLT
EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS
SSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKD
FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32033
NameBDBM32033
Synonyms:1-butyl-2-(2-furoylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylic acid ethyl ester | 1-butyl-2-[[2-furanyl(oxo)methyl]amino]-3-pyrrolo[3,2-b]quinoxalinecarboxylic acid ethyl ester | MLS000079916 | SMR000040037 | cid_659124 | ethyl 1-butyl-2-(furan-2-carbonylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylate | ethyl 1-butyl-2-(furan-2-ylcarbonylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylate
TypeSmall organic molecule
Emp. Form.C22H22N4O4
Mol. Mass.406.4345
SMILESCCCCn1c(NC(=O)c2ccco2)c(C(=O)OCC)c2nc3ccccc3nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM32033
Synonyms:1-butyl-2-(2-furoylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylic acid ethyl ester | 1-butyl-2-[[2-furanyl(oxo)methyl]amino]-3-pyrrolo[3,2-b]quinoxalinecarboxylic acid ethyl ester | MLS000079916 | SMR000040037 | cid_659124 | ethyl 1-butyl-2-(furan-2-carbonylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylate | ethyl 1-butyl-2-(furan-2-ylcarbonylamino)pyrrolo[3,2-b]quinoxaline-3-carboxylate
TypeSmall organic molecule
Emp. Form.C22H22N4O4
Mol. Mass.406.4345
SMILESCCCCn1c(NC(=O)c2ccco2)c(C(=O)OCC)c2nc3ccccc3nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: