Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetToll-like receptor 9 (TLR9)
LigandBDBM273527
Substrate/Competitorn/a
Meas. Tech.TLR7/8/9 Inhibition Reporter Assay
Temperature298.15±n/a K
IC50 112±n/a nM
Commentsextracted
Citation Dyckman, AJDodd, DSMacor, JEMussari, CPPasunoori, LKumar, SRSherwood, TCSistla, RK [1,2,4]triazolo[1,5-a]pyridinyl substituted indole compounds US Patent US10071079 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
Toll-like receptor 9 (TLR9)
Name:Toll-like receptor 9 (TLR9)
Synonyms:Toll-like receptor 9
Type:Enzyme
Mol. Mass.:115889.91
Organism:Homo sapiens (Human)
Description:Q9NR96
Residue:1032
Sequence:
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM273527
NameBDBM273527
Synonyms:US10071079, Example 310
TypeSmall organic molecule
Emp. Form.C30H41N7O2S
Mol. Mass.563.757
SMILESCC(C)c1c([nH]c2ccc(cc12)C1CCN(CCS(C)(=O)=O)CC1)-c1cc(N2CCN(C)CC2)c2ncnn2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a