Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(4) dopamine receptor
LigandBDBM84453
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 1.4±0.0 nM
Citation Hendrix, JAShimshock, SJShutske, GMTomer, JDKapples, KJPalermo, MGCorbett, TJVargas, HMKafka, SBrooks, KMLaws-Ricker, LLee, DKde Lannoy, IBordeleau, MRizkalla, GOwolabi, JKamboj, RK Synthesis and structure-activity relationship of the isoindolinyl benzisoxazolpiperidines as potent, selective, and orally active human dopamine D4 receptor antagonists. Chembiochem3:999-1009 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(4) dopamine receptor
Name:D(4) dopamine receptor
Synonyms:D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84453
NameBDBM84453
Synonyms:Isoindoline, 20
TypeSmall organic molecule
Emp. Form.C24H28FN3O3
Mol. Mass.425.4958
SMILESCOc1cccc2CN(CC(CO)N3CCC(CC3)c3noc4cc(F)ccc34)Cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a