Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 3
LigandBDBM274257
Substrate/Competitorn/a
Meas. Tech.TR-FRET In-Vitro Binding Assay
pH7.5±n/a
IC50 28.0±n/a nM
Commentsextracted
Citation Rueger, HBlank, JBordas, VCotesta, SBold, GGuagnano, VVaupel, A Pyrrolopyrrolone derivatives and their use as BET inhibitors US Patent US9550796 Publication Date 1/24/2017
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 3
Name:Bromodomain-containing protein 3
Synonyms:Bromodomain-containing protein 3 | Bromodomain-containing protein 3 (BRD3) | RING3-like protein
Type:Protein
Mol. Mass.:79571.81
Organism:Homo sapiens (Human)
Description:Q15059
Residue:726
Sequence:
MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFY
QPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTD
DIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPA
TPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKK
GVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ
HAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLST
VKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAAL
SQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKA
NSTTTAGRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ
SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPFSASGKKQAAKSKEEL
AQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPSRLSSSSSSESGSSSSSGSSS
DSSDSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM274257
NameBDBM274257
Synonyms:(R)-6-(4-chlorophenyl)-2-(2,4-dimethoxypyrimidin-5-yl)-5-(1,5-dimethyl-6-oxo-1,6-dihydropyridin-3-yl)-1-methyl-5,6-dihydropyrrolo[3,4-b]pyrrol-4(1H)-one | US9550796, Example 54
TypeSmall organic molecule
Emp. Form.C26H24ClN5O4
Mol. Mass.505.953
SMILESCOc1ncc(-c2cc3C(=O)N([C@@H](c3n2C)c2ccc(Cl)cc2)c2cc(C)c(=O)n(C)c2)c(OC)n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a